PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026906P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 282aa    MW: 31918.8 Da    PI: 6.9952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026906P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++ ++ +G+g +W + +++ g++R++k+c++rw++yl
   MELO3C026906P1 14 KGPWSPEEDSKLKHHIETYGTGgNWISLPQKAGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.74.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd  +  +++  G++ W+ Ia+ ++ gRt++++k++w++
   MELO3C026906P1  69 GEFSAEEDTVICTLFATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.671962IPR017930Myb domain
SuperFamilySSF466891.33E-2611109IPR009057Homeodomain-like
SMARTSM007171.7E-111364IPR001005SANT/Myb domain
PfamPF002492.8E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-231569IPR009057Homeodomain-like
CDDcd001671.09E-81662No hitNo description
PROSITE profilePS5129420.83863117IPR017930Myb domain
SMARTSM007173.3E-1167115IPR001005SANT/Myb domain
PfamPF002491.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2370117IPR009057Homeodomain-like
CDDcd001671.07E-770113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKHHIE TYGTGGNWIS LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FSAEEDTVIC TLFATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMMG  120
MVSSSSTTNT THYAPQAEIV KTIETLSPKP HQNPSFDYQP LSNNSYEPLG SANYSIPLFN  180
YCNNPISSCL VTNPFDQNNS FYETLKPNQV GFEFDELEYG GLNSVSFNNG LLFDEKMKMM  240
QQNNNGNEGY NGNYVEGNAM MKEEEEMMEQ KREEEAKRST K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24111174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819350.0LN681935.1 Cucumis melo genomic scaffold, unanchored_scaffold00115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465353.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A067FAN83e-80A0A067FAN8_CITSI; Uncharacterized protein
TrEMBLV4UEI63e-80V4UEI6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.14e-75myb domain protein 68